PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00081189001
Common NameGSBRNA2T00081189001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 271aa    MW: 30694.7 Da    PI: 7.7882
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00081189001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.61.2e-3774133261
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          ++k+l+cprC+s++tkfCyynny++sqPr+fC++C+ryWt GG++r vPvG+grrknk +
  GSBRNA2T00081189001  74 PDKILPCPRCNSADTKFCYYNNYNVSQPRHFCRNCQRYWTSGGSMRTVPVGSGRRKNKGW 133
                          7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2874131IPR003851Zinc finger, Dof-type
PfamPF027012.6E-3176131IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.33278132IPR003851Zinc finger, Dof-type
PROSITE patternPS01361080116IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MEYSSSSSFP SLGLYMMNNQ SATDNSEQDD TTLQMSSDLN KESKETSENN YDKHSEITTT  60
TTTSEEKTTE LKKPDKILPC PRCNSADTKF CYYNNYNVSQ PRHFCRNCQR YWTSGGSMRT  120
VPVGSGRRKN KGWVSTDLID INSKNNSNDY NSSSTKILSF ESSDSWVSEK GQHRSSDSKM  180
TADSVSQDFN KFQGFLPAQV TSSVSPPWPY HQYPLNPSFY HIPVCWGYTV PVSSTLETST  240
CLGKRTRGEA SHENVREQRH FRESKVKFTL *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893851e-124AC189385.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB052E19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009110034.11e-140PREDICTED: dof zinc finger protein DOF1.3-like
SwissprotQ9LQX41e-120DOF13_ARATH; Dof zinc finger protein DOF1.3
TrEMBLA0A078I6F10.0A0A078I6F1_BRANA; BnaCnng12240D protein
TrEMBLA0A0D3DR940.0A0A0D3DR94_BRAOL; Uncharacterized protein
STRINGBra016286.1-P1e-139(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM140821624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26790.11e-105Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]